Lineage for d1jo8a_ (1jo8 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.34: SH3-like barrel [50036] (10 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (23 proteins) Protein Actin binding protein ABP1 [74920] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74921] (1 PDB entry) 
Domain d1jo8a_: 1jo8 A: [71774]
Details for d1jo8a_
PDB Entry: 1jo8 (more details), 1.3 Å
PDB Description: Structural analysis of the yeast actin binding protein Abp1 SH3 domain
SCOP Domain Sequences for d1jo8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae)}
pwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn
SCOP Domain Coordinates for d1jo8a_:
Click to download the PDB-style file with coordinates for d1jo8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jo8a_:
- d1jo8a_ is new in SCOP 1.61
- d1jo8a_ appears in SCOP 1.63
- d1jo8a_ appears in the current release, SCOPe 2.08
View in 3D