Lineage for d1jnzc3 (1jnz C:2257-2401)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001258Protein Adenylylsulfate reductase A subunit [69852] (1 species)
  7. 3001259Species Archaeoglobus fulgidus [TaxId:2234] [69853] (2 PDB entries)
  8. 3001263Domain d1jnzc3: 1jnz C:2257-2401 [71772]
    Other proteins in same PDB: d1jnza1, d1jnza2, d1jnzb_, d1jnzc1, d1jnzc2, d1jnzd_
    complexed with fad, sf4, so3

Details for d1jnzc3

PDB Entry: 1jnz (more details), 2.5 Å

PDB Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution
PDB Compounds: (C:) adenylylsulfate reductase

SCOPe Domain Sequences for d1jnzc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnzc3 d.168.1.1 (C:2257-2401) Adenylylsulfate reductase A subunit {Archaeoglobus fulgidus [TaxId: 2234]}
fehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaelekykpygaaqpiptpl
rnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafedfldmtvsqallwacq
nidpqeqpseaapaepyimgshsge

SCOPe Domain Coordinates for d1jnzc3:

Click to download the PDB-style file with coordinates for d1jnzc3.
(The format of our PDB-style files is described here.)

Timeline for d1jnzc3: