Lineage for d1jnzc1 (1jnz C:2503-2643)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724459Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1724460Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1724461Protein Adenylylsulfate reductase A subunit [68978] (1 species)
  7. 1724462Species Archaeoglobus fulgidus [TaxId:2234] [68979] (2 PDB entries)
  8. 1724466Domain d1jnzc1: 1jnz C:2503-2643 [71770]
    Other proteins in same PDB: d1jnza2, d1jnza3, d1jnzb_, d1jnzc2, d1jnzc3, d1jnzd_
    complexed with fad, sf4, so3

Details for d1jnzc1

PDB Entry: 1jnz (more details), 2.5 Å

PDB Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution
PDB Compounds: (C:) adenylylsulfate reductase

SCOPe Domain Sequences for d1jnzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnzc1 a.7.3.1 (C:2503-2643) Adenylylsulfate reductase A subunit {Archaeoglobus fulgidus [TaxId: 2234]}
taddvnpeyilpwqglvrlqkimdeyaagiatiyktnekmlqralellaflkedleklaa
rdlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyyrtdypelndeewkcfvcskyd
aekdewtfekvpyvqviewsf

SCOPe Domain Coordinates for d1jnzc1:

Click to download the PDB-style file with coordinates for d1jnzc1.
(The format of our PDB-style files is described here.)

Timeline for d1jnzc1: