Lineage for d1jnud_ (1jnu D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577060Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 2577064Protein Photoreceptor phy3 flavin-binding domain, lov2 [64354] (1 species)
  7. 2577065Species Maidenhair fern (Adiantum capillus-veneris) [TaxId:13818] [64355] (2 PDB entries)
  8. 2577069Domain d1jnud_: 1jnu D: [71765]
    complexed with fmn

Details for d1jnud_

PDB Entry: 1jnu (more details), 2.6 Å

PDB Description: Photoexcited structure of the plant photoreceptor domain, phy3 LOV2
PDB Compounds: (D:) phy3 protein

SCOPe Domain Sequences for d1jnud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnud_ d.110.3.6 (D:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]}
ksfvitdprlpdnpiifasdrflelteytreevlgnncrflqgrgtdrkavqlirdavke
qrdvtvqvlnytkggrafwnlfhlqvmrdengdvqyfigvqqem

SCOPe Domain Coordinates for d1jnud_:

Click to download the PDB-style file with coordinates for d1jnud_.
(The format of our PDB-style files is described here.)

Timeline for d1jnud_: