| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins) contains PAC motif |
| Protein Photoreceptor phy3 flavin-binding domain, lov2 [64354] (1 species) |
| Species Maidenhair fern (Adiantum capillus-veneris) [TaxId:13818] [64355] (2 PDB entries) |
| Domain d1jnub_: 1jnu B: [71763] complexed with fmn |
PDB Entry: 1jnu (more details), 2.6 Å
SCOPe Domain Sequences for d1jnub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnub_ d.110.3.6 (B:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]}
ksfvitdprlpdnpiifasdrflelteytreevlgnncrflqgrgtdrkavqlirdavke
qrdvtvqvlnytkggrafwnlfhlqvmrdengdvqyfigvqqem
Timeline for d1jnub_: