SCOP 1.71: Domain d1jnia_: 1jni A:

Lineage for d1jnia_ (1jni A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Periplasmic nitrate reductase subunit NapB [74805] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [74806] (1 PDB entry)

8. Domain d1jnia_: 1jni A: [71761]
   complexed with hem

Details for d1jnia_

PDB Entry: 1jni, 1.25 Å

PDB Description: structure of the napb subunit of the periplasmic nitrate reductase from haemophilus influenzae.

SCOP Domain Sequences for d1jnia_:

Sequence, based on SEQRES records:

>d1jnia_ a.138.1.3 (A:) Periplasmic nitrate reductase subunit NapB {Haemophilus influenzae}
nqppmvphsvanyqvtknvnqclnchspensrlsgatrispthfmdrdgkvgssssprry
fclqchvs

Sequence, based on observed residues (ATOM records):

>d1jnia_ a.138.1.3 (A:) Periplasmic nitrate reductase subunit NapB {Haemophilus influenzae}
nqppmvphsvanyqvtknvnqclnchspensrlsgatrispthfmdrdgkvsprryfclq
chvs

Timeline for d1jnia_:

• d1jnia_ first appeared in SCOP 1.61
  
• d1jnia_ appears in SCOP 1.69
  
• d1jnia_ appears in SCOP 1.73
  
• d1jnia_ appears in the current release, SCOPe 2.08