Lineage for d1jnea2 (1jne A:279-370)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410016Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 410161Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 410162Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 410260Protein Imaginal disc growth factor-2 [75392] (1 species)
  7. 410261Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75393] (2 PDB entries)
  8. 410263Domain d1jnea2: 1jne A:279-370 [71760]
    Other proteins in same PDB: d1jnea1
    complexed with man, nag

Details for d1jnea2

PDB Entry: 1jne (more details), 1.7 Å

PDB Description: crystal structure of imaginal disc growth factor-2

SCOP Domain Sequences for d1jnea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnea2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster)}
ygnawkltkdsglegvpvvpetsgpapegfqsqkpgllsyaeicgklsnpqnqflkgnes
plrrvsdptkrfggiayrpvdgqitegiwvsy

SCOP Domain Coordinates for d1jnea2:

Click to download the PDB-style file with coordinates for d1jnea2.
(The format of our PDB-style files is described here.)

Timeline for d1jnea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnea1