![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Imaginal disc growth factor-2 [75392] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75393] (2 PDB entries) |
![]() | Domain d1jnea2: 1jne A:279-370 [71760] Other proteins in same PDB: d1jnea1 complexed with man, nag |
PDB Entry: 1jne (more details), 1.7 Å
SCOP Domain Sequences for d1jnea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnea2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster)} ygnawkltkdsglegvpvvpetsgpapegfqsqkpgllsyaeicgklsnpqnqflkgnes plrrvsdptkrfggiayrpvdgqitegiwvsy
Timeline for d1jnea2: