Lineage for d1jnda2 (1jnd A:279-370)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327256Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 327386Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 327387Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 327457Protein Imaginal disc growth factor-2 [75392] (1 species)
  7. 327458Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75393] (2 PDB entries)
  8. 327459Domain d1jnda2: 1jnd A:279-370 [71758]
    Other proteins in same PDB: d1jnda1
    complexed with man, nag

Details for d1jnda2

PDB Entry: 1jnd (more details), 1.3 Å

PDB Description: crystal structure of imaginal disc growth factor-2

SCOP Domain Sequences for d1jnda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster)}
ygnawkltkdsglegvpvvpetsgpapegfqsqkpgllsyaeicgklsnpqnqflkgnes
plrrvsdptkrfggiayrpvdgqitegiwvsy

SCOP Domain Coordinates for d1jnda2:

Click to download the PDB-style file with coordinates for d1jnda2.
(The format of our PDB-style files is described here.)

Timeline for d1jnda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnda1