Lineage for d1jnda1 (1jnd A:2-278,A:371-420)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385175Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 385298Protein Imaginal disc growth factor-2 [75071] (1 species)
  7. 385299Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75072] (2 PDB entries)
  8. 385300Domain d1jnda1: 1jnd A:2-278,A:371-420 [71757]
    Other proteins in same PDB: d1jnda2
    complexed with man, nag

Details for d1jnda1

PDB Entry: 1jnd (more details), 1.3 Å

PDB Description: crystal structure of imaginal disc growth factor-2

SCOP Domain Sequences for d1jnda1:

Sequence, based on SEQRES records: (download)

>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster)}
snlvcyydsssytreglgkllnpdleialqfcshlvygyaglrgenlqaysmnenldiyk
hqfsevtslkrkyphlkvllsvggdhdidpdhpnkyidllegekvrqigfirsayelvkt
ygfdgldlayqfpknkprkvhgdlglawksikklftgdfivdphaalhkeqftalvrdvk
dslradgfllsltvlpnvnstwyfdipalnglvdfvnlatfdfltparnpeeadysapiy
hpdgskdrlahlnadfqveywlsqgfpsnkinlgvatXddpdsasnkaayarvknlggva
lfdlsyddfrgqcsgdkypilraikyrl

Sequence, based on observed residues (ATOM records): (download)

>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster)}
snlvcyydsssytreglgkllnpdleialqfcshlvygyaglrgenlqaysmnenldiyk
hqfsevtslkrkyphlkvllsvggdhdidpdhpnkyidllegekvrqigfirsayelvkt
ygfdgldlayqfpknkprkvivdphaalhkeqftalvrdvkdslradgfllsltvlpnvn
stwyfdipalnglvdfvnlatfdfltparnpeeadysapiyhpdgskdrlahlnadfqve
ywlsqgfpsnkinlgvatXddpdsasnkaayarvknlggvalfdlsyddfrgqcsgdkyp
ilraikyrl

SCOP Domain Coordinates for d1jnda1:

Click to download the PDB-style file with coordinates for d1jnda1.
(The format of our PDB-style files is described here.)

Timeline for d1jnda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnda2