Lineage for d1jnda1 (1jnd A:2-278,A:371-420)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083331Protein Imaginal disc growth factor-2 [75071] (1 species)
  7. 2083332Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75072] (2 PDB entries)
  8. 2083333Domain d1jnda1: 1jnd A:2-278,A:371-420 [71757]
    Other proteins in same PDB: d1jnda2
    complexed with man

Details for d1jnda1

PDB Entry: 1jnd (more details), 1.3 Å

PDB Description: Crystal structure of imaginal disc growth factor-2
PDB Compounds: (A:) Imaginal disc growth factor-2

SCOPe Domain Sequences for d1jnda1:

Sequence, based on SEQRES records: (download)

>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
snlvcyydsssytreglgkllnpdleialqfcshlvygyaglrgenlqaysmnenldiyk
hqfsevtslkrkyphlkvllsvggdhdidpdhpnkyidllegekvrqigfirsayelvkt
ygfdgldlayqfpknkprkvhgdlglawksikklftgdfivdphaalhkeqftalvrdvk
dslradgfllsltvlpnvnstwyfdipalnglvdfvnlatfdfltparnpeeadysapiy
hpdgskdrlahlnadfqveywlsqgfpsnkinlgvatXddpdsasnkaayarvknlggva
lfdlsyddfrgqcsgdkypilraikyrl

Sequence, based on observed residues (ATOM records): (download)

>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
snlvcyydsssytreglgkllnpdleialqfcshlvygyaglrgenlqaysmnenldiyk
hqfsevtslkrkyphlkvllsvggdhdidpdhpnkyidllegekvrqigfirsayelvkt
ygfdgldlayqfpknkprkvivdphaalhkeqftalvrdvkdslradgfllsltvlpnvn
stwyfdipalnglvdfvnlatfdfltparnpeeadysapiyhpdgskdrlahlnadfqve
ywlsqgfpsnkinlgvatXddpdsasnkaayarvknlggvalfdlsyddfrgqcsgdkyp
ilraikyrl

SCOPe Domain Coordinates for d1jnda1:

Click to download the PDB-style file with coordinates for d1jnda1.
(The format of our PDB-style files is described here.)

Timeline for d1jnda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnda2