Lineage for d1jmma_ (1jmm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2045260Superfamily b.30.6: V-region of surface antigen I/II (SA I/II, PAC) [74914] (1 family) (S)
    automatically mapped to Pfam PF08363
  5. 2045261Family b.30.6.1: V-region of surface antigen I/II (SA I/II, PAC) [74915] (1 protein)
  6. 2045262Protein V-region of surface antigen I/II (SA I/II, PAC) [74916] (1 species)
  7. 2045263Species Streptococcus mutans [TaxId:1309] [74917] (1 PDB entry)
  8. 2045264Domain d1jmma_: 1jmm A: [71749]
    complexed with na

Details for d1jmma_

PDB Entry: 1jmm (more details), 2.4 Å

PDB Description: Crystal structure of the V-region of Streptococcus mutans antigen I/II
PDB Compounds: (A:) protein I/II V-region

SCOPe Domain Sequences for d1jmma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmma_ b.30.6.1 (A:) V-region of surface antigen I/II (SA I/II, PAC) {Streptococcus mutans [TaxId: 1309]}
qkdladypvklkayedeqasikaalaelekhknedgnltepsaqnlvydlepnanlsltt
dgkflkasavddafskstskakyvqkilqlddlditnleqsndvassmelygnfgdkagw
sttvsnnsqvkwgsvllergqsatatytnlqnsyyngkkiskivykytvdpkskfqgqkv
wlgiftdptlgvfasaytgqvekntsifikneftfydedgkpinfdnallsvaslnrehn
siemakdysgkfvkisgssigekngmiyatdtlnfkqgeggsrwtmyknsqagsgwdssd
apnswygagaikmsgpnnhvtvgatsatnvmpvsdmpvvpgkdntdgkkpniwyslngki
ravnvpkvtkekptppv

SCOPe Domain Coordinates for d1jmma_:

Click to download the PDB-style file with coordinates for d1jmma_.
(The format of our PDB-style files is described here.)

Timeline for d1jmma_: