SCOPe 2.06: Domain d1jmko_: 1jmk O:

Lineage for d1jmko_ (1jmk O:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 proteins)
   Pfam PF00975

6. Protein Surfactin synthetase, SrfA [75290] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75291] (1 PDB entry)

8. Domain d1jmko_: 1jmk O: [71748]
   complexed with so4

Details for d1jmko_

PDB Entry: 1jmk, 1.71 Å

PDB Description: Structural Basis for the Cyclization of the Lipopeptide Antibiotic Surfactin by the Thioesterase Domain SrfTE

PDB Compounds: (O:) Surfactin Synthetase

SCOPe Domain Sequences for d1jmko_:

Sequence; same for both SEQRES and ATOM records:

>d1jmko_ c.69.1.22 (O:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}
ggsdglqdvtimnqdqeqiifafppvlgyglmyqnlssrlpsyklcafdfieeedrldry
adliqklqpegpltlfgysagcslafeaakklegqgrivqriimvdsykkqgvsdldgrt
vesdvealmnvnrdnealnseavkhglkqkthafysyyvnlistgqvkadidlltsgadf
dipewlasweeattgayrmkrgfgthaemlqgetldrnagilleflntqt

Timeline for d1jmko_:

• d1jmko_ first appeared in SCOP 1.61
  
• d1jmko_ appears in SCOPe 2.05
  
• d1jmko_ appears in SCOPe 2.07
  
• d1jmko_ appears in the current release, SCOPe 2.08