Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 proteins) Pfam PF00975 |
Protein Surfactin synthetase, SrfA [75290] (1 species) |
Species Bacillus subtilis [TaxId:1423] [75291] (1 PDB entry) |
Domain d1jmko_: 1jmk O: [71748] complexed with so4 |
PDB Entry: 1jmk (more details), 1.71 Å
SCOPe Domain Sequences for d1jmko_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmko_ c.69.1.22 (O:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} ggsdglqdvtimnqdqeqiifafppvlgyglmyqnlssrlpsyklcafdfieeedrldry adliqklqpegpltlfgysagcslafeaakklegqgrivqriimvdsykkqgvsdldgrt vesdvealmnvnrdnealnseavkhglkqkthafysyyvnlistgqvkadidlltsgadf dipewlasweeattgayrmkrgfgthaemlqgetldrnagilleflntqt
Timeline for d1jmko_: