SCOP 1.67: Domain d1jm1a_: 1jm1 A:

Lineage for d1jm1a_ (1jm1 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (7 proteins)

6. Protein Rieske protein II (SoxF) [74918] (1 species)

7. Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [74919] (1 PDB entry)

8. Domain d1jm1a_: 1jm1 A: [71745]
   complexed with fes, mg

Details for d1jm1a_

PDB Entry: 1jm1, 1.11 Å

PDB Description: Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius

SCOP Domain Sequences for d1jm1a_:

Sequence; same for both SEQRES and ATOM records:

>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius}
ntdglagfprykvaniqqvqqqikssgcavyffaypltdepcflvdlqaltgqqiteipn
pyygkyagplgqiqtikgvgpngtifafsdvcvhlgcqlpaqvivssesdpglyakgadl
hcpchgsiyalkdggvvvsgpaprplpivildydsstgdiyavgtnapyfsagiprttpq
dnllydprysysvpnnpscsng

Timeline for d1jm1a_:

• d1jm1a_ first appeared in SCOP 1.61
  
• d1jm1a_ appears in SCOP 1.65
  
• d1jm1a_ appears in SCOP 1.69
  
• d1jm1a_ appears in the current release, SCOPe 2.08