Lineage for d1jm1a_ (1jm1 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.33: ISP domain [50021] (1 superfamily) Superfamily b.33.1: ISP domain [50022] (2 families) 
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins) Protein Rieske protein II (SoxF) [74918] (1 species) Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [74919] (1 PDB entry) 
Domain d1jm1a_: 1jm1 A: [71745]
Details for d1jm1a_
PDB Entry: 1jm1 (more details), 1.11 Å
PDB Description: Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius
SCOP Domain Sequences for d1jm1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius}
ntdglagfprykvaniqqvqqqikssgcavyffaypltdepcflvdlqaltgqqiteipn
pyygkyagplgqiqtikgvgpngtifafsdvcvhlgcqlpaqvivssesdpglyakgadl
hcpchgsiyalkdggvvvsgpaprplpivildydsstgdiyavgtnapyfsagiprttpq
dnllydprysysvpnnpscsng
SCOP Domain Coordinates for d1jm1a_:
Click to download the PDB-style file with coordinates for d1jm1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jm1a_:
- d1jm1a_ is new in SCOP 1.61
- d1jm1a_ appears in SCOP 1.63
- d1jm1a_ appears in the current release, SCOPe 2.08
View in 3D