SCOPe 2.03: Domain d1jlvc1: 1jlv C:85-207

Lineage for d1jlvc1 (1jlv C:85-207)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class delta GST [81355] (6 species)
   formerly a part of class theta enzymes

7. Species Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId:123217] [74724] (1 PDB entry)

8. Domain d1jlvc1: 1jlv C:85-207 [71733]
   Other proteins in same PDB: d1jlva2, d1jlvb2, d1jlvc2, d1jlvd2, d1jlve2, d1jlvf2
   complexed with gsh

Details for d1jlvc1

PDB Entry: 1jlv, 1.75 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-3

PDB Compounds: (C:) glutathione transferase GST1-3

SCOPe Domain Sequences for d1jlvc1:

Sequence; same for both SEQRES and ATOM records:

>d1jlvc1 a.45.1.1 (C:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}
kdpqkravvnqrlyfdmgtlyqrfadyyypqifakqpanaenekkmkdavdflntfldgh
kyvagdsltiadltvlatvstydvagfelakyphvaawyertrkeapgaaineagieefr
kyf

Timeline for d1jlvc1:

• d1jlvc1 first appeared in SCOP 1.61
  
• d1jlvc1 appears in SCOPe 2.02
  
• d1jlvc1 appears in SCOPe 2.04
  
• d1jlvc1 appears in the current release, SCOPe 2.08