| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class delta GST [81355] (6 species) formerly a part of class theta enzymes |
| Species Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId:123217] [74724] (1 PDB entry) |
| Domain d1jlva1: 1jlv A:85-207 [71729] Other proteins in same PDB: d1jlva2, d1jlvb2, d1jlvc2, d1jlvd2, d1jlve2, d1jlvf2 complexed with gsh |
PDB Entry: 1jlv (more details), 1.75 Å
SCOPe Domain Sequences for d1jlva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}
kdpqkravvnqrlyfdmgtlyqrfadyyypqifakqpanaenekkmkdavdflntfldgh
kyvagdsltiadltvlatvstydvagfelakyphvaawyertrkeapgaaineagieefr
kyf
Timeline for d1jlva1: