Lineage for d1jlkb_ (1jlk B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1586638Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1586808Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)
  7. 1586815Species Synechocystis sp. PCC 6803, RCP1 [TaxId:1148] [75153] (2 PDB entries)
  8. 1586819Domain d1jlkb_: 1jlk B: [71728]
    mn(2+)-bound form
    complexed with mn, so4

Details for d1jlkb_

PDB Entry: 1jlk (more details), 2.3 Å

PDB Description: Crystal structure of the Mn(2+)-bound form of response regulator Rcp1
PDB Compounds: (B:) response regulator rcp1

SCOPe Domain Sequences for d1jlkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlkb_ c.23.1.1 (B:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]}
pkvillvedskadsrlvqevlktstidheliilrdglaamaflqqqgeyensprpnlill
dlnlpkkdgrevlaeikqnpdlkripvvvlttshneddviasyelhvncyltksrnlkdl
fkmvqgiesfwletvtlpa

SCOPe Domain Coordinates for d1jlkb_:

Click to download the PDB-style file with coordinates for d1jlkb_.
(The format of our PDB-style files is described here.)

Timeline for d1jlkb_: