SCOPe 2.04: Domain d1jlkb_: 1jlk B:

Lineage for d1jlkb_ (1jlk B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)

7. Species Synechocystis sp. PCC 6803, RCP1 [TaxId:1148] [75153] (2 PDB entries)

8. Domain d1jlkb_: 1jlk B: [71728]
   mn(2+)-bound form
   complexed with mn, so4

Details for d1jlkb_

PDB Entry: 1jlk, 2.3 Å

PDB Description: Crystal structure of the Mn(2+)-bound form of response regulator Rcp1

PDB Compounds: (B:) response regulator rcp1

SCOPe Domain Sequences for d1jlkb_:

Sequence; same for both SEQRES and ATOM records:

>d1jlkb_ c.23.1.1 (B:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]}
pkvillvedskadsrlvqevlktstidheliilrdglaamaflqqqgeyensprpnlill
dlnlpkkdgrevlaeikqnpdlkripvvvlttshneddviasyelhvncyltksrnlkdl
fkmvqgiesfwletvtlpa

Timeline for d1jlkb_:

• d1jlkb_ first appeared in SCOP 1.61
  
• d1jlkb_ appears in SCOPe 2.03
  
• d1jlkb_ appears in SCOPe 2.05
  
• d1jlkb_ appears in the current release, SCOPe 2.08