| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein Response regulator for cyanobacterial phytochrome [75152] (3 species) |
| Species Synechocystis sp. PCC 6803, RCP1 [TaxId:1148] [75153] (2 PDB entries) |
| Domain d1jlka_: 1jlk A: [71727] mn(2+)-bound form complexed with mn, so4 |
PDB Entry: 1jlk (more details), 2.3 Å
SCOPe Domain Sequences for d1jlka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlka_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]}
nppkvillvedskadsrlvqevlktstidheliilrdglaamaflqqqgeyensprpnli
lldlnlpkkdgrevlaeikqnpdlkripvvvlttshneddviasyelhvncyltksrnlk
dlfkmvqgiesfwletvtlpa
Timeline for d1jlka_: