Lineage for d1jlka_ (1jlk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837876Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)
  7. 1837883Species Synechocystis sp. PCC 6803, RCP1 [TaxId:1148] [75153] (2 PDB entries)
  8. 1837886Domain d1jlka_: 1jlk A: [71727]
    mn(2+)-bound form
    complexed with mn, so4

Details for d1jlka_

PDB Entry: 1jlk (more details), 2.3 Å

PDB Description: Crystal structure of the Mn(2+)-bound form of response regulator Rcp1
PDB Compounds: (A:) response regulator rcp1

SCOPe Domain Sequences for d1jlka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlka_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]}
nppkvillvedskadsrlvqevlktstidheliilrdglaamaflqqqgeyensprpnli
lldlnlpkkdgrevlaeikqnpdlkripvvvlttshneddviasyelhvncyltksrnlk
dlfkmvqgiesfwletvtlpa

SCOPe Domain Coordinates for d1jlka_:

Click to download the PDB-style file with coordinates for d1jlka_.
(The format of our PDB-style files is described here.)

Timeline for d1jlka_: