SCOPe 2.06: Domain d1jl6a_: 1jl6 A:

Lineage for d1jl6a_ (1jl6 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Glycera globin [46467] (1 species)

7. Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)

8. Domain d1jl6a_: 1jl6 A: [71725]
   component IV
   complexed with cyn, hem

Details for d1jl6a_

PDB Entry: 1jl6, 1.4 Å

PDB Description: Crystal Structure of CN-Ligated Component IV Glycera Dibranchiata Monomeric Hemoglobin

PDB Compounds: (A:) monomer hemoglobin component IV

SCOPe Domain Sequences for d1jl6a_:

Sequence; same for both SEQRES and ATOM records:

>d1jl6a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

Timeline for d1jl6a_:

• d1jl6a_ first appeared in SCOP 1.61
  
• d1jl6a_ appears in SCOPe 2.05
  
• d1jl6a_ appears in SCOPe 2.07
  
• d1jl6a_ appears in the current release, SCOPe 2.08