SCOP 1.61: Domain d1jkve_: 1jkv E:

Lineage for d1jkve_ (1jkv E:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)

6. Protein Manganese catalase (T-catalase) [47263] (2 species)

7. Species Lactobacillus plantarum [TaxId:1590] [74707] (2 PDB entries)

8. Domain d1jkve_: 1jkv E: [71723]

Details for d1jkve_

PDB Entry: 1jkv, 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide

SCOP Domain Sequences for d1jkve_:

Sequence; same for both SEQRES and ATOM records:

>d1jkve_ a.25.1.2 (E:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

Timeline for d1jkve_:

• d1jkve_ is new in SCOP 1.61
  
• d1jkve_ appears in SCOP 1.63
  
• d1jkve_ appears in the current release, SCOPe 2.08