Lineage for d1jkve_ (1jkv E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990434Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 protein domains)
    automatically mapped to Pfam PF05067
  6. 1990435Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 1990436Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 1990447Domain d1jkve_: 1jkv E: [71723]
    complexed with azi, ca, edo, mn3, oh

Details for d1jkve_

PDB Entry: 1jkv (more details), 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide
PDB Compounds: (E:) pseudocatalase

SCOPe Domain Sequences for d1jkve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkve_ a.25.1.3 (E:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOPe Domain Coordinates for d1jkve_:

Click to download the PDB-style file with coordinates for d1jkve_.
(The format of our PDB-style files is described here.)

Timeline for d1jkve_: