Lineage for d1jkvd_ (1jkv D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766909Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)
  6. 766910Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 766911Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 766915Domain d1jkvd_: 1jkv D: [71722]

Details for d1jkvd_

PDB Entry: 1jkv (more details), 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide
PDB Compounds: (D:) pseudocatalase

SCOP Domain Sequences for d1jkvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkvd_ a.25.1.3 (D:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOP Domain Coordinates for d1jkvd_:

Click to download the PDB-style file with coordinates for d1jkvd_.
(The format of our PDB-style files is described here.)

Timeline for d1jkvd_: