Lineage for d1jkvb_ (1jkv B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314523Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
    automatically mapped to Pfam PF05067
  6. 2314524Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 2314525Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 2314533Domain d1jkvb_: 1jkv B: [71720]
    complexed with azi, ca, edo, mn3, oh

Details for d1jkvb_

PDB Entry: 1jkv (more details), 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide
PDB Compounds: (B:) pseudocatalase

SCOPe Domain Sequences for d1jkvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkvb_ a.25.1.3 (B:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOPe Domain Coordinates for d1jkvb_:

Click to download the PDB-style file with coordinates for d1jkvb_.
(The format of our PDB-style files is described here.)

Timeline for d1jkvb_: