Lineage for d1jkue_ (1jku E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639357Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)
  6. 639358Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 639359Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 639376Domain d1jkue_: 1jku E: [71717]

Details for d1jkue_

PDB Entry: 1jku (more details), 1.84 Å

PDB Description: Crystal Structure of Manganese Catalase from Lactobacillus plantarum
PDB Compounds: (E:) pseudocatalase

SCOP Domain Sequences for d1jkue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkue_ a.25.1.3 (E:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOP Domain Coordinates for d1jkue_:

Click to download the PDB-style file with coordinates for d1jkue_.
(The format of our PDB-style files is described here.)

Timeline for d1jkue_: