SCOPe 2.05: Domain d1jkud_: 1jku D:

Lineage for d1jkud_ (1jku D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
   automatically mapped to Pfam PF05067

6. Protein Manganese catalase (T-catalase) [47263] (2 species)

7. Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)

8. Domain d1jkud_: 1jku D: [71716]
   complexed with ca, mn3, oh

Details for d1jkud_

PDB Entry: 1jku, 1.84 Å

PDB Description: Crystal Structure of Manganese Catalase from Lactobacillus plantarum

PDB Compounds: (D:) pseudocatalase

SCOPe Domain Sequences for d1jkud_:

Sequence; same for both SEQRES and ATOM records:

>d1jkud_ a.25.1.3 (D:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

Timeline for d1jkud_:

• d1jkud_ first appeared in SCOP 1.61
  
• d1jkud_ appears in SCOPe 2.04
  
• d1jkud_ appears in SCOPe 2.06
  
• d1jkud_ appears in the current release, SCOPe 2.08