Class a: All alpha proteins [46456] (179 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (2 families) contains dimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins) |
Protein Manganese catalase (T-catalase) [47263] (1 species) |
Species Lactobacillus plantarum [TaxId:1590] [74707] (2 PDB entries) |
Domain d1jkud_: 1jku D: [71716] |
PDB Entry: 1jku (more details), 1.84 Å
SCOP Domain Sequences for d1jkud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkud_ a.25.1.2 (D:) Manganese catalase (T-catalase) {Lactobacillus plantarum} mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft yqenpeamggiphikpgdprlhnhqg
Timeline for d1jkud_: