SCOP 1.71: Domain d1jkuc_: 1jku C:

Lineage for d1jkuc_ (1jku C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)

6. Protein Manganese catalase (T-catalase) [47263] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)

8. Domain d1jkuc_: 1jku C: [71715]

Details for d1jkuc_

PDB Entry: 1jku, 1.84 Å

PDB Description: Crystal Structure of Manganese Catalase from Lactobacillus plantarum

SCOP Domain Sequences for d1jkuc_:

Sequence; same for both SEQRES and ATOM records:

>d1jkuc_ a.25.1.3 (C:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

Timeline for d1jkuc_:

• d1jkuc_ first appeared in SCOP 1.61
  
• d1jkuc_ appears in SCOP 1.69
  
• d1jkuc_ appears in SCOP 1.73
  
• d1jkuc_ appears in the current release, SCOPe 2.08