SCOPe 2.05: Domain d1jkka_: 1jkk A:

Lineage for d1jkka_ (1jkk A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Death-associated protein kinase, Dap [75560] (1 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75561] (20 PDB entries)
   Uniprot P53355 2-285

8. Domain d1jkka_: 1jkk A: [71708]
   complexed with anp, mg

Details for d1jkka_

PDB Entry: 1jkk, 2.4 Å

PDB Description: 2.4a x-ray structure of ternary complex of a catalytic domain of death-associated protein kinase with atp analogue and mg.

PDB Compounds: (A:) death-associated protein kinase

SCOPe Domain Sequences for d1jkka_:

Sequence, based on SEQRES records:

>d1jkka_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqf

Sequence, based on observed residues (ATOM records):

>d1jkka_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpf

Timeline for d1jkka_:

• d1jkka_ first appeared in SCOP 1.61
  
• d1jkka_ appears in SCOPe 2.04
  
• d1jkka_ appears in SCOPe 2.06
  
• d1jkka_ appears in the current release, SCOPe 2.08