Lineage for d1jkib2 (1jki B:323-437)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259192Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 259193Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 259348Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 259379Protein Myo-inositol 1-phosphate synthase [75484] (2 species)
  7. 259380Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (3 PDB entries)
  8. 259382Domain d1jkib2: 1jki B:323-437 [71707]
    Other proteins in same PDB: d1jkia1, d1jkib1
    complexed with dg6, nai, nh4

Details for d1jkib2

PDB Entry: 1jki (more details), 2.2 Å

PDB Description: myo-Inositol-1-phosphate Synthase Complexed with an Inhibitor, 2-deoxy-glucitol-6-phosphate

SCOP Domain Sequences for d1jkib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkib2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

SCOP Domain Coordinates for d1jkib2:

Click to download the PDB-style file with coordinates for d1jkib2.
(The format of our PDB-style files is described here.)

Timeline for d1jkib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jkib1