Lineage for d1jkfb2 (1jkf B:323-437)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193860Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 193861Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 194013Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 194042Protein Myo-inositol 1-phosphate synthase [75484] (2 species)
  7. 194043Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (3 PDB entries)
  8. 194047Domain d1jkfb2: 1jkf B:323-437 [71703]
    Other proteins in same PDB: d1jkfa1, d1jkfb1

Details for d1jkfb2

PDB Entry: 1jkf (more details), 2.4 Å

PDB Description: holo 1l-myo-inositol-1-phosphate synthase

SCOP Domain Sequences for d1jkfb2:

Sequence, based on SEQRES records: (download)

>d1jkfb2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records): (download)

>d1jkfb2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhskvamdeyyselmlgghnrisihnvce

SCOP Domain Coordinates for d1jkfb2:

Click to download the PDB-style file with coordinates for d1jkfb2.
(The format of our PDB-style files is described here.)

Timeline for d1jkfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jkfb1