Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Myo-inositol 1-phosphate synthase [75105] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries) |
Domain d1jkfb1: 1jkf B:10-322,B:438-533 [71702] Other proteins in same PDB: d1jkfa2, d1jkfb2 |
PDB Entry: 1jkf (more details), 2.4 Å
SCOP Domain Sequences for d1jkfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkfb1 c.2.1.3 (B:10-322,B:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)} tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla ehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltf lsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
Timeline for d1jkfb1: