Lineage for d1jkfb1 (1jkf B:10-322,B:438-533)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 478095Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 478101Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries)
  8. 478117Domain d1jkfb1: 1jkf B:10-322,B:438-533 [71702]
    Other proteins in same PDB: d1jkfa2, d1jkfb2

Details for d1jkfb1

PDB Entry: 1jkf (more details), 2.4 Å

PDB Description: holo 1l-myo-inositol-1-phosphate synthase

SCOP Domain Sequences for d1jkfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkfb1 c.2.1.3 (B:10-322,B:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
ehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltf
lsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

SCOP Domain Coordinates for d1jkfb1:

Click to download the PDB-style file with coordinates for d1jkfb1.
(The format of our PDB-style files is described here.)

Timeline for d1jkfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jkfb2