Lineage for d1jkfa2 (1jkf A:323-437)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527526Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2527608Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2527616Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)
    Uniprot P11986
  8. 2527631Domain d1jkfa2: 1jkf A:323-437 [71701]
    Other proteins in same PDB: d1jkfa1, d1jkfb1
    complexed with nad

Details for d1jkfa2

PDB Entry: 1jkf (more details), 2.4 Å

PDB Description: holo 1l-myo-inositol-1-phosphate synthase
PDB Compounds: (A:) myo-inositol-1-phosphate synthase

SCOPe Domain Sequences for d1jkfa2:

Sequence, based on SEQRES records: (download)

>d1jkfa2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records): (download)

>d1jkfa2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhgdskvamdeyyselmlgghnrisihnvce

SCOPe Domain Coordinates for d1jkfa2:

Click to download the PDB-style file with coordinates for d1jkfa2.
(The format of our PDB-style files is described here.)

Timeline for d1jkfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jkfa1