Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Viral structural mimic of eIF2alpha [74952] (2 species) |
Species Myxoma virus, m156r [TaxId:10273] [74954] (1 PDB entry) |
Domain d1jjga_: 1jjg A: [71696] |
PDB Entry: 1jjg (more details)
SCOPe Domain Sequences for d1jjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]} mtvikpssrprprknknikvntyrtsamdlspgsvhegivyfkdgifkvrllgyegheci lldylnyrqdtldrlkerlvgrviktrvvradglyvdlrrff
Timeline for d1jjga_: