Lineage for d1jjga_ (1jjg A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125422Protein Viral structural mimic of eIF2alpha [74952] (2 species)
  7. 1125423Species Myxoma virus, m156r [TaxId:10273] [74954] (1 PDB entry)
  8. 1125424Domain d1jjga_: 1jjg A: [71696]

Details for d1jjga_

PDB Entry: 1jjg (more details)

PDB Description: solution structure of myxoma virus protein m156r
PDB Compounds: (A:) m156r

SCOPe Domain Sequences for d1jjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]}
mtvikpssrprprknknikvntyrtsamdlspgsvhegivyfkdgifkvrllgyegheci
lldylnyrqdtldrlkerlvgrviktrvvradglyvdlrrff

SCOPe Domain Coordinates for d1jjga_:

Click to download the PDB-style file with coordinates for d1jjga_.
(The format of our PDB-style files is described here.)

Timeline for d1jjga_: