Lineage for d1jiqd_ (1jiq D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140303Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2140314Species Human (Homo sapiens) [TaxId:9606] [64176] (5 PDB entries)
  8. 2140319Domain d1jiqd_: 1jiq D: [71692]

Details for d1jiqd_

PDB Entry: 1jiq (more details), 1.9 Å

PDB Description: Crystal Structure of Human Autocrine Motility Factor
PDB Compounds: (D:) autocrine motility factor

SCOPe Domain Sequences for d1jiqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiqd_ c.80.1.2 (D:) Phosphoglucose isomerase, PGI {Human (Homo sapiens) [TaxId: 9606]}
maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv
tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp
evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava
khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn
gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft
kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda
stnglinfikqqrearv

SCOPe Domain Coordinates for d1jiqd_:

Click to download the PDB-style file with coordinates for d1jiqd_.
(The format of our PDB-style files is described here.)

Timeline for d1jiqd_: