SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jiqa_ (1jiq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140303Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2140314Species Human (Homo sapiens) [TaxId:9606] [64176] (5 PDB entries)
  8. 2140316Domain d1jiqa_: 1jiq A: [71689]

Details for d1jiqa_

PDB Entry: 1jiq (more details), 1.9 Å

PDB Description: Crystal Structure of Human Autocrine Motility Factor
PDB Compounds: (A:) autocrine motility factor

SCOPe Domain Sequences for d1jiqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiqa_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Human (Homo sapiens) [TaxId: 9606]}
maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv
tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp
evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava
khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn
gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft
kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda
stnglinfikqqrearv

SCOPe Domain Coordinates for d1jiqa_:

Click to download the PDB-style file with coordinates for d1jiqa_.
(The format of our PDB-style files is described here.)

Timeline for d1jiqa_: