SCOP 1.73: Domain d1jiga_: 1jig A:

Lineage for d1jiga_ (1jig A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein Dodecameric ferritin homolog [47250] (13 species)

7. Species Bacillus anthracis, Dlp-2 [TaxId:1392] [74706] (1 PDB entry)

8. Domain d1jiga_: 1jig A: [71685]

Details for d1jiga_

PDB Entry: 1jig, 1.46 Å

PDB Description: Dlp-2 from Bacillus anthracis

PDB Compounds: (A:) Dlp-2

SCOP Domain Sequences for d1jiga_:

Sequence; same for both SEQRES and ATOM records:

>d1jiga_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2 [TaxId: 1392]}
stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
atsadmllaihttleqhvwmlsaflk

Timeline for d1jiga_:

• d1jiga_ first appeared in SCOP 1.61
  
• d1jiga_ appears in SCOP 1.71
  
• d1jiga_ appears in SCOP 1.75
  
• d1jiga_ appears in the current release, SCOPe 2.08