Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Bacillus anthracis, Dlp-2 [TaxId:1392] [74706] (1 PDB entry) |
Domain d1jiga_: 1jig A: [71685] |
PDB Entry: 1jig (more details), 1.46 Å
SCOP Domain Sequences for d1jiga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jiga_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2 [TaxId: 1392]} stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd atsadmllaihttleqhvwmlsaflk
Timeline for d1jiga_: