Lineage for d1jiga_ (1jig A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151501Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 151583Protein Dodecameric ferritin homolog [47250] (4 species)
  7. 151589Species Bacillus anthracis, Dlp-2 [TaxId:1392] [74706] (1 PDB entry)
  8. 151590Domain d1jiga_: 1jig A: [71685]

Details for d1jiga_

PDB Entry: 1jig (more details), 1.46 Å

PDB Description: Dlp-2 from Bacillus anthracis

SCOP Domain Sequences for d1jiga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiga_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2}
stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
atsadmllaihttleqhvwmlsaflk

SCOP Domain Coordinates for d1jiga_:

Click to download the PDB-style file with coordinates for d1jiga_.
(The format of our PDB-style files is described here.)

Timeline for d1jiga_: