SCOPe 2.06: Domain d1ji7c1: 1ji7 C:15-91

Lineage for d1ji7c1 (1ji7 C:15-91)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)

8. Domain d1ji7c1: 1ji7 C:15-91 [71684]
   Other proteins in same PDB: d1ji7c2
   complexed with so4

Details for d1ji7c1

PDB Entry: 1ji7, 1.45 Å

PDB Description: crystal structure of tel sam polymer

PDB Compounds: (C:) ets-related protein tel1

SCOPe Domain Sequences for d1ji7c1:

Sequence; same for both SEQRES and ATOM records:

>d1ji7c1 a.60.1.1 (C:15-91) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdelyellqhilkq

Timeline for d1ji7c1:

• d1ji7c1 first appeared in SCOP 1.61, called d1ji7c_
  
• d1ji7c1 was called d1ji7c_ in SCOPe 2.05
  
• d1ji7c1 appears in SCOPe 2.07
  
• d1ji7c1 appears in the current release, SCOPe 2.08