Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (14 species) |
Species Bacillus anthracis, Dlp-1 [TaxId:1392] [74705] (1 PDB entry) |
Domain d1ji5d_: 1ji5 D: [71681] complexed with fe, mpd |
PDB Entry: 1ji5 (more details), 2.5 Å
SCOPe Domain Sequences for d1ji5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji5d_ a.25.1.1 (D:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1 [TaxId: 1392]} qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts dlllgiytelekhawmlrafln
Timeline for d1ji5d_: