Lineage for d1ji5b_ (1ji5 B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151501Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 151583Protein Dodecameric ferritin homolog [47250] (4 species)
  7. 151584Species Bacillus anthracis, Dlp-1 [TaxId:1392] [74705] (1 PDB entry)
  8. 151586Domain d1ji5b_: 1ji5 B: [71679]

Details for d1ji5b_

PDB Entry: 1ji5 (more details), 2.5 Å

PDB Description: Dlp-1 from bacillus anthracis

SCOP Domain Sequences for d1ji5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji5b_ a.25.1.1 (B:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1}
qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
dlllgiytelekhawmlrafln

SCOP Domain Coordinates for d1ji5b_:

Click to download the PDB-style file with coordinates for d1ji5b_.
(The format of our PDB-style files is described here.)

Timeline for d1ji5b_: