![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (16 species) |
![]() | Species Bacillus anthracis, Dlp-1 [TaxId:1392] [74705] (1 PDB entry) |
![]() | Domain d1ji5a_: 1ji5 A: [71678] complexed with fe, mpd |
PDB Entry: 1ji5 (more details), 2.5 Å
SCOPe Domain Sequences for d1ji5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji5a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1 [TaxId: 1392]} qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts dlllgiytelekhawmlrafln
Timeline for d1ji5a_: