SCOP 1.75: Domain d1ji2b2: 1ji2 B:503-585

Lineage for d1ji2b2 (1ji2 B:503-585)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)

8. Domain d1ji2b2: 1ji2 B:503-585 [71676]
   Other proteins in same PDB: d1ji2a1, d1ji2a3, d1ji2b1, d1ji2b3
   complexed with ca

Details for d1ji2b2

PDB Entry: 1ji2, 2.3 Å

PDB Description: Improved X-ray Structure of Thermoactinomyces vulgaris R-47 alpha-Amylase 2

PDB Compounds: (B:) alpha-amylase II

SCOP Domain Sequences for d1ji2b2:

Sequence; same for both SEQRES and ATOM records:

>d1ji2b2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1ji2b2:

• d1ji2b2 first appeared in SCOP 1.61
  
• d1ji2b2 appears in SCOP 1.73
  
• d1ji2b2 appears in SCOPe 2.01
  
• d1ji2b2 appears in the current release, SCOPe 2.08