SCOP 1.63: Domain d1ji2b1: 1ji2 B:1-120

Lineage for d1ji2b1 (1ji2 B:1-120)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)

8. Domain d1ji2b1: 1ji2 B:1-120 [71675]
   Other proteins in same PDB: d1ji2a2, d1ji2a3, d1ji2b2, d1ji2b3
   complexed with ca

Details for d1ji2b1

PDB Entry: 1ji2, 2.3 Å

PDB Description: Improved X-ray Structure of Thermoactinomyces vulgaris R-47 alpha-Amylase 2

SCOP Domain Sequences for d1ji2b1:

Sequence; same for both SEQRES and ATOM records:

>d1ji2b1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1ji2b1:

• d1ji2b1 first appeared in SCOP 1.61
  
• d1ji2b1 appears in SCOP 1.65
  
• d1ji2b1 appears in the current release, SCOPe 2.08