Lineage for d1ji2a3 (1ji2 A:121-502)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305662Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 305893Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 305902Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (7 PDB entries)
  8. 305903Domain d1ji2a3: 1ji2 A:121-502 [71674]
    Other proteins in same PDB: d1ji2a1, d1ji2a2, d1ji2b1, d1ji2b2

Details for d1ji2a3

PDB Entry: 1ji2 (more details), 2.3 Å

PDB Description: Improved X-ray Structure of Thermoactinomyces vulgaris R-47 alpha-Amylase 2

SCOP Domain Sequences for d1ji2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji2a3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOP Domain Coordinates for d1ji2a3:

Click to download the PDB-style file with coordinates for d1ji2a3.
(The format of our PDB-style files is described here.)

Timeline for d1ji2a3: