Lineage for d1ji2a2 (1ji2 A:503-585)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 676035Protein Maltogenic amylase [51031] (4 species)
  7. 676050Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)
  8. 676057Domain d1ji2a2: 1ji2 A:503-585 [71673]
    Other proteins in same PDB: d1ji2a1, d1ji2a3, d1ji2b1, d1ji2b3

Details for d1ji2a2

PDB Entry: 1ji2 (more details), 2.3 Å

PDB Description: Improved X-ray Structure of Thermoactinomyces vulgaris R-47 alpha-Amylase 2
PDB Compounds: (A:) alpha-amylase II

SCOP Domain Sequences for d1ji2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji2a2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1ji2a2:

Click to download the PDB-style file with coordinates for d1ji2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ji2a2: