Lineage for d1ji1b3 (1ji1 B:123-554)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093379Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 2093383Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75061] (8 PDB entries)
  8. 2093386Domain d1ji1b3: 1ji1 B:123-554 [71671]
    Other proteins in same PDB: d1ji1a1, d1ji1a2, d1ji1b1, d1ji1b2
    complexed with ca

Details for d1ji1b3

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1
PDB Compounds: (B:) alpha-amylase I

SCOPe Domain Sequences for d1ji1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1b3 c.1.8.1 (B:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrldaaqyvd
angnngsdvtnhqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgftq
pvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsgg
dlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqkli
tirnqypalrtg

SCOPe Domain Coordinates for d1ji1b3:

Click to download the PDB-style file with coordinates for d1ji1b3.
(The format of our PDB-style files is described here.)

Timeline for d1ji1b3: