| Class b: All beta proteins [48724] (165 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Maltogenic amylase [51031] (4 species) |
| Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (9 PDB entries) |
| Domain d1ji1b2: 1ji1 B:555-637 [71670] Other proteins in same PDB: d1ji1a1, d1ji1a3, d1ji1b1, d1ji1b3 complexed with ca |
PDB Entry: 1ji1 (more details), 1.6 Å
SCOP Domain Sequences for d1ji1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji1b2 b.71.1.1 (B:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq
Timeline for d1ji1b2: