Lineage for d1ji1b2 (1ji1 B:555-637)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 171081Protein Maltogenic amylase [51031] (4 species)
  7. 171085Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (1 PDB entry)
  8. 171087Domain d1ji1b2: 1ji1 B:555-637 [71670]
    Other proteins in same PDB: d1ji1a1, d1ji1a3, d1ji1b1, d1ji1b3

Details for d1ji1b2

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1
PDB Compounds: (B:)

SCOP Domain Sequences for d1ji1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1b2 b.71.1.1 (B:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOP Domain Coordinates for d1ji1b2:

Click to download the PDB-style file with coordinates for d1ji1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ji1b2: