Lineage for d1ji1b1 (1ji1 B:1-122)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160787Protein Maltogenic amylase, N-terminal domain [49221] (4 species)
  7. 160791Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (1 PDB entry)
  8. 160793Domain d1ji1b1: 1ji1 B:1-122 [71669]
    Other proteins in same PDB: d1ji1a2, d1ji1a3, d1ji1b2, d1ji1b3

Details for d1ji1b1

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1
PDB Compounds: (B:)

SCOP Domain Sequences for d1ji1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1b1 b.1.1.5 (B:1-122) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAI}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

SCOP Domain Coordinates for d1ji1b1:

Click to download the PDB-style file with coordinates for d1ji1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ji1b1: